PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015895394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 685aa    MW: 73929.1 Da    PI: 6.6911
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015895394.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.85.2e-28247300155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv+av+qL G +kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  XP_015895394.1 247 KPRVVWSVELHQQFVSAVNQL-GLDKAVPKRILELMNVPGLTRENVASHLQKFRL 300
                     79*******************.********************************8 PP

2Response_reg75.42.1e-25631711109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+ + + +l+++l++  y +v+++ ++++al+ll+e++  +D++l D+ mp+mdG++ll++   e  +lp+i+++a g+ + + + ++ G
  XP_015895394.1  63 VLVVDDDTTCLTILEKMLRRCLY-HVTTCFQATAALKLLRERKgcFDVVLSDVYMPDMDGYKLLEHVGLEM-DLPVIMMSADGSTSAVMRGIRHG 155
                     89*********************.*******************************************6644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_015895394.1 156 ACDYLIKPIREEELKN 171
                     *************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.2E-4260197No hitNo description
SuperFamilySSF521721.71E-3560190IPR011006CheY-like superfamily
SMARTSM004481.5E-3061173IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.57462177IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2263171IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.29E-2664176No hitNo description
PROSITE profilePS5129410.353244303IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-30244305IPR009057Homeodomain-like
SuperFamilySSF466892.33E-19245304IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24247300IPR006447Myb domain, plants
PfamPF002492.7E-7249298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MAALQRVAQS SISTTASSYG SCKGAGVTTT TTTNTSTKTA TSSSAAVASE MVVSDKFPVG  60
LRVLVVDDDT TCLTILEKML RRCLYHVTTC FQATAALKLL RERKGCFDVV LSDVYMPDMD  120
GYKLLEHVGL EMDLPVIMMS ADGSTSAVMR GIRHGACDYL IKPIREEELK NIWQHVVRKK  180
WNENKELENS GSLEDNDRHK QVNDDAEYTS SVNEGTEGSL KCQKKRSNSK EEDDGELEND  240
DPSSSKKPRV VWSVELHQQF VSAVNQLGLD KAVPKRILEL MNVPGLTREN VASHLQKFRL  300
YLKRISGVAQ QQTGISSAFC GSVEPNVKLG SLGRFDIQAL AASGQIPPQT LAALHAELLG  360
RPTGNLVPAL DQPTLLHATL QGPKRGPVEH SVPFGQPLVK CQTNISKHFP PSILPVEDVS  420
SGFGAWPSNS LGTVGSSINL GGLSTQNSNT LMDILQQQQQ KQLQTQQQSV LSESSRSINV  480
QPSCLVVPQT SPGFQLGNSP ASVNQNCSFN RNTVIDYSIL SSQSSDSSVN VGQISNGDIK  540
ATGILSGYST PASCSSLSSC SLNATTSTTH QSSTVTFGDA RRFPGLISNT SNIQGSYDAK  600
PGEVLDQGHL KNLGFVGKGT CIPSRFAVDE FESSPSNMNQ GKVNLEKNGN TVKQEPNMDF  660
LDNAKIGVPI LRQYSSNELM SVFTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-23243306164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895393.10.0PREDICTED: two-component response regulator ORR21
RefseqXP_015895394.10.0PREDICTED: two-component response regulator ORR21
SwissprotA2XE311e-170ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-170ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLM5XK720.0M5XK72_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g05830.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-126response regulator 2